DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP011325

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_309327.4 Gene:AgaP_AGAP011325 / 1270612 VectorBaseID:AGAP011325 Length:631 Species:Anopheles gambiae


Alignment Length:261 Identity:77/261 - (29%)
Similarity:122/261 - (46%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGD----HVCGGSIYSENIIVTAAHCF-------------FD 71
            |::|..|....:.|.||...||   |    .||||::.::..::||||||             ||
Mosquito   382 EEKIANGIDAILFQYPWMALLQ---DTELAFVCGGTLINKRYVLTAAHCFREKLSKISVRLGEFD 443

  Fly    72 EEGN-RLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQP 135
            .:.: ..|.:|.:    .||...:   :.|...|.|::|:....:||||::||::...:...|.|
Mosquito   444 LKSDIDCDKRGER----CALPPQD---IAVERTIKHKDYSARHKVNDIALIRLASEASYNENVMP 501

  Fly   136 I--PLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQ-GLALHIKSIFSCRLF---------D 188
            |  |::......:.|..|||||::.  ||:::   ..|| ||...:.:....:|.         :
Mosquito   502 ICLPVSPEMRTVKEIYYVSGWGLTE--NDTSS---DVLQVGLLRQLPNDVCQQLLQRKDKYVTVN 561

  Fly   189 PSLLCAGTYGRT-ACHGDSGGPL---VVNKQLV--GVVSWGRKGC---VSSAFFVSVPYFREWIL 244
            ...:||....|| .|.|||||||   .||.:.|  ||||:|.:.|   .:...:..|..:.:|||
Mosquito   562 SDQMCAIGANRTDNCSGDSGGPLKTVAVNARFVQYGVVSYGLRTCGKETAPGVYTRVENYIDWIL 626

  Fly   245 N 245
            :
Mosquito   627 D 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/255 (29%)
Tryp_SPc 27..243 CDD:238113 73/254 (29%)
AgaP_AGAP011325XP_309327.4 Tryp_SPc 44..287 CDD:238113
Tryp_SPc 46..286 CDD:214473
Tryp_SPc 384..625 CDD:214473 73/255 (29%)
Tryp_SPc 385..625 CDD:238113 73/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.