DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP006707

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_309036.1 Gene:AgaP_AGAP006707 / 1270350 VectorBaseID:AGAP006707 Length:255 Species:Anopheles gambiae


Alignment Length:276 Identity:82/276 - (29%)
Similarity:124/276 - (44%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFLLLLALDFLSAGQVNRW----EQRIIGGEPIGIEQVPWQVSLQYFG-DHVCGGSIYSEN 60
            |..::|:|:.....:||.::.:.    ..|::|||.......|:|||||..| .|.||||:.:..
Mosquito     1 MLRKAFILVSTCLVVSAAKLPKLVLDDGYRVVGGEVAKNGSAPYQVSLQIPGHGHNCGGSLLNSR 65

  Fly    61 IIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLST 125
            .::|||||....|...:     ||..|:......|.|.....| .|..||.....|||.::||..
Mosquito    66 WVLTAAHCIVGHEPTNI-----QVLVGTNSLKEGGQLYKPDKL-FHHNYASPEFRNDIGLIRLKE 124

  Fly   126 PLEFTSKVQPIPLAKTNPYPRSIAL-VSGWG----------------VSYILND---STNLYPTH 170
            .::|:..||.|..:: ...|.::.: ::|||                |..:.|:   :.:|||.|
Mosquito   125 EVQFSEIVQSIEYSE-QVVPANVTVRLTGWGRTSAGGSVPTLLQSLNVVTLTNEDCKAKSLYPEH 188

  Fly   171 LQGLALHIKSIFSCRLFDPSLLCA-GTYGRTACHGDSGGPLVVNKQLVGVVSWGRK-GCVSSAFF 233
            :                |...||. ...|..||:||||||||...:|||||::|.. |......|
Mosquito   189 V----------------DVGHLCTLSRSGEGACNGDSGGPLVYEGKLVGVVNFGVPCGLGYPDGF 237

  Fly   234 VSVPYFREWILNAIAS 249
            ..|.|:.:||...:|:
Mosquito   238 ARVSYYHDWIRTTMAN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 74/239 (31%)
Tryp_SPc 27..243 CDD:238113 73/238 (31%)
AgaP_AGAP006707XP_309036.1 Tryp_SPc 30..247 CDD:214473 74/239 (31%)
Tryp_SPc 31..250 CDD:238113 75/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.