DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CLIPA10

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_308802.3 Gene:CLIPA10 / 1270130 VectorBaseID:AGAP006954 Length:1130 Species:Anopheles gambiae


Alignment Length:244 Identity:71/244 - (29%)
Similarity:109/244 - (44%) Gaps:50/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QVPWQVSL----QYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTL 97
            :.||||::    .....:||||::.....|:|||||.....|..|     :||.|.  .|.|..:
Mosquito   893 EYPWQVAILKKDPKESVYVCGGTLIDNLYIITAAHCVKTYNGFDL-----RVRLGE--WDVNHDV 950

  Fly    98 V-------DVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLA---KTNPYPRSIALVS 152
            .       |:.::.:|.||......||:||:::..|::.||.....|..   |...:.......:
Mosquito   951 EFYPYIERDIISVQVHPEYYAGTLDNDLAILKMDRPVDLTSAPHIAPACLPDKHTDFSGQRCWTT 1015

  Fly   153 GWGVSYILNDSTNLYPTH---LQGLALHIKSIFSC-------RL-----FDPSLLCA-GTYGRTA 201
            |||     .|:...|..:   |:.:.:.|.:.:.|       ||     .:...:|| |..|:.|
Mosquito  1016 GWG-----KDAFGDYGKYQNILKEVDVPIVNHYQCQNQLRQTRLGYTYNLNQGFICAGGEEGKDA 1075

  Fly   202 CHGDSGGPLVVNK----QLVGVVSWGRKGCVSS---AFFVSVPYFREWI 243
            |.||.|||||..:    |:||||||| .||..:   ..:|.|.::.:||
Mosquito  1076 CKGDGGGPLVCERNGVWQVVGVVSWG-IGCGQANVPGVYVKVAHYLDWI 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 69/242 (29%)
Tryp_SPc 27..243 CDD:238113 69/242 (29%)
CLIPA10XP_308802.3 Tryp_SPc 888..1126 CDD:238113 71/244 (29%)
Tryp_SPc 888..1123 CDD:214473 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.