DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP012670

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_307656.4 Gene:AgaP_AGAP012670 / 1269074 VectorBaseID:AGAP012670 Length:267 Species:Anopheles gambiae


Alignment Length:241 Identity:74/241 - (30%)
Similarity:109/241 - (45%) Gaps:38/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ||:.|:.:.|.:..:.:||:..|...||.:|.:.:..:|||||.:....   |.....:..||..
Mosquito    36 RIVNGKAVSIVKYKYALSLRVNGVFDCGATIITNSHSLTAAHCVYKYPS---DPSRVTLYGGSTS 97

  Fly    91 TDSNGTLVDVAALIIHEEY-------AFDLNINDIAIVRLSTPL-EFTSKVQPIPLA-KTNPYP- 145
            |.|.|..|.|.::.:|..|       |.|.   |:|:  |:.|: .|:.:....||| :||..| 
Mosquito    98 TSSGGIEVPVVSIALHPNYNRKGFPAASDC---DVAV--LTVPVNSFSGRPNMAPLALQTNELPV 157

  Fly   146 RSIALVSGWG-VSYILNDSTNLYPTHLQGLALHIKSIFSC-------RLFDPSLLCAG-TYGRTA 201
            .:...|.||| ..|....|.|    .|:...::|.|..:|       |.|   ::||. ..|...
Mosquito   158 GTECFVIGWGRTGYNQPASVN----QLRYANMNIVSQSTCATIWAEYRKF---MICAKYNNGVDT 215

  Fly   202 CHGDSGGPLVVNKQLVGVVSWGRKGCVSS--AFF--VSVPYFREWI 243
            |.|||||.||....|.||||:....|.|:  |.|  ::.|..|.:|
Mosquito   216 CGGDSGGALVCGGGLAGVVSFSHPNCTSAWPAGFAKITAPSIRSFI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/239 (31%)
Tryp_SPc 27..243 CDD:238113 72/238 (30%)
AgaP_AGAP012670XP_307656.4 Tryp_SPc 36..254 CDD:214473 71/232 (31%)
Tryp_SPc 37..263 CDD:238113 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.