DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP012473

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_307308.4 Gene:AgaP_AGAP012473 / 1268739 VectorBaseID:AGAP012473 Length:272 Species:Anopheles gambiae


Alignment Length:237 Identity:71/237 - (29%)
Similarity:106/237 - (44%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ||:.|.|:.|....:.:|::..|:..||.||.:.:..::||||.::..|.|::...|   .||..
Mosquito    36 RIVNGVPVNISNYKYALSMRLNGEFRCGASIITCSHALSAAHCVYNLTGPRIELTLY---GGSTS 97

  Fly    91 TDSNGTLVDVAALIIHEEYA--FDLNINDIAIVRLSTPL-EFTSKVQPIPLA-KTNPYP-RSIAL 150
            ..|.|....|....||..|.  ...|.:|..:..|:.|. .|:.:....||| :|...| .:...
Mosquito    98 ASSGGVEFPVVGGAIHPYYKPNSQSNTSDYDVAILNVPANSFSGRPNMAPLALQTKELPVGTRCF 162

  Fly   151 VSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL----FD------PSLLCAGTY-GRTACHG 204
            |.|||.:   .::..:....|....::|.|..||..    |:      ..::||..| |...|.|
Mosquito   163 VVGWGRT---GENQPVSTNQLLYANMNIVSQSSCASMWANFEKLCAECKHMVCAQYYNGMDTCRG 224

  Fly   205 DSGGPLVVNKQLVGVVSWGR--KGCVSSAFF-VSVPYFREWI 243
            ||||.||...:|.||||:|.  .|...|.|. |:.|..|.:|
Mosquito   225 DSGGALVCGGRLTGVVSFGPYCSGVWPSVFAKVTAPSMRSFI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/235 (30%)
Tryp_SPc 27..243 CDD:238113 69/234 (29%)
AgaP_AGAP012473XP_307308.4 Tryp_SPc 36..266 CDD:214473 70/235 (30%)
Tryp_SPc 37..267 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.