DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CMA1

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001827.1 Gene:CMA1 / 1215 HGNCID:2097 Length:247 Species:Homo sapiens


Alignment Length:261 Identity:71/261 - (27%)
Similarity:108/261 - (41%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQ-RIIGGEPIGIEQVPWQVSLQYFGDH----VCGGSIYSENIIVTAA 66
            :|||.|..|.....:|.|. .||||........|:...|:....:    .|||.:...|.::|||
Human     1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAA 65

  Fly    67 HCFFDEEGNRLDDQGYQVRAGSALTDSNGT-----------LVDVAALIIHEEYAFDLNINDIAI 120
            ||                 ||.::|.:.|.           .::|.....|.:|......:||.:
Human    66 HC-----------------AGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIML 113

  Fly   121 VRLSTPLEFTSKVQPIPLAKTNPY--PRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFS 183
            ::|......|..|..:|......:  |..:..|:|||.:.:|...::.    ||.:.|.:....:
Human   114 LKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDT----LQEVKLRLMDPQA 174

  Fly   184 C---RLFDPSL-LCAGTYGRT--ACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAFFVSVPYFREW 242
            |   |.||.:| ||.|...:|  |..|||||||:......|:||:||......|.|..:.::|.|
Human   175 CSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPW 239

  Fly   243 I 243
            |
Human   240 I 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 62/239 (26%)
Tryp_SPc 27..243 CDD:238113 62/238 (26%)
CMA1NP_001827.1 Tryp_SPc 22..243 CDD:238113 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.