DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC116407686

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031749385.1 Gene:LOC116407686 / 116407686 -ID:- Length:403 Species:Xenopus tropicalis


Alignment Length:287 Identity:85/287 - (29%)
Similarity:125/287 - (43%) Gaps:63/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALDFLSAGQVNRWE------QRII-----GGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENI 61
            ||.|:..||.|.....|      ||::     ||:.......||||:::......||||:.:...
 Frog     6 LLGAVFLLSWGTYRTTEAQQLCGQRLVSSGVMGGQDSQPGMWPWQVNIRSQSGGFCGGSLITSKW 70

  Fly    62 IVTAAHCFFDEEGNRLDDQGYQVRAGS---ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRL 123
            :|:||||.    .:.|....|.|.|||   :.|:.|...:.|...|||..|....|.:||.::.|
 Frog    71 VVSAAHCC----DSTLTPSNYTVYAGSYNLSGTNPNEVSITVKNFIIHPNYTAAENGSDICLMEL 131

  Fly   124 STPLEFTSKVQPIPL-AKTNPYPRSI-ALVSGWG------------------VSYI-LNDSTNLY 167
            .|.|.||..:.|:.| |....:|..: ..|:|||                  |..| ..|..|.|
 Frog   132 GTELNFTQYIAPVCLPASGVTFPTGLPCWVTGWGEPAFNVSLPSPVTLQQESVPLIGSQDCNNYY 196

  Fly   168 PTHLQGLALHIKSIFSCRLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQ----LVGVVSWGRKG 226
            .:|     .:||.         .::|||..  |:.:|.||||||||..:.    |||:||:| ..
 Frog   197 ASH-----PYIKD---------DMICAGNVSGGKGSCQGDSGGPLVCAEADRWFLVGIVSFG-LS 246

  Fly   227 CVSSAF---FVSVPYFREWILNAIASI 250
            |....:   :..:..|.:||.::|.::
 Frog   247 CQQPNYPEVYGRINGFLDWITSSIPNV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 74/254 (29%)
Tryp_SPc 27..243 CDD:238113 73/253 (29%)
LOC116407686XP_031749385.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.