DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss28

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:258 Identity:83/258 - (32%)
Similarity:123/258 - (47%) Gaps:54/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALD------FLSAGQVNRWEQ-RIIGGEPIGIEQVPWQVSLQYFG------DHVCGGSIYS 58
            ||||||.      |:::..::|.:. .|:||:.....:.||||||:.:.      .|:|||||..
Mouse     4 LLLLALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIH 68

  Fly    59 ENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRL 123
            ...|:|||||...::.   |...|:|:.|.........|::::.:|||.:|.......|:|:::|
Mouse    69 PQWILTAAHCIQSQDA---DPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQL 130

  Fly   124 STPLEFTSKVQPIPLAKTNPYPRSI--ALVSGWGVSYILNDSTNLY-------PTHLQGLALHIK 179
            :..|..::.|.|:.|.|.:....|.  ..:.|||         ||.       |..|..:.:.|:
Mouse   131 TALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWG---------NLLQRVPLQPPYQLHEVKIPIQ 186

  Fly   180 SIFSCR---------------LFDPSLLCAGTYGRTACHGDSGGPLVV---NKQL-VGVVSWG 223
            ...||:               :|| .:|||||.||..|.||||||||.   ||.: |||||.|
Mouse   187 DNKSCKRAYRKKSSDEHKAVAIFD-DMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/232 (32%)
Tryp_SPc 27..243 CDD:238113 75/231 (32%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 75/231 (32%)
Tryp_SPc 31..269 CDD:214473 75/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.