DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP013487

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_003436426.1 Gene:AgaP_AGAP013487 / 11176153 VectorBaseID:AGAP013487 Length:308 Species:Anopheles gambiae


Alignment Length:266 Identity:73/266 - (27%)
Similarity:125/266 - (46%) Gaps:57/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQY------FGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQV 84
            |::.|:...|::.||...:::      ||.| ||||:.::..|||||||.   :....|.:..:|
Mosquito    55 RVLSGQSTQIDEFPWTALIEFQKPDGSFGFH-CGGSLINDRYIVTAAHCI---KSIPRDWKVQRV 115

  Fly    85 RAGS-ALTDSNGTL----------VDVAALIIHEEYAFDL----NINDIAIVRLSTPLEFTSKVQ 134
            |.|. .||.:|...          :|:..:::|..|  |.    |.||||::|.:.|:.::..|:
Mosquito   116 RLGEWDLTSANDCQNEFCSDAPIDLDIEQIVVHTGY--DTKDKSNANDIALIRFTRPVNYSQTVR 178

  Fly   135 PI--PLA---KTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR--------L 186
            ||  ||:   :...:...|:...||..:    :|.......|: :.:.|||:..|.        |
Mosquito   179 PICLPLSSSLRNRSHDGLISYEVGWRKT----NSATASEKKLK-VEVEIKSLQECAPIYERNGIL 238

  Fly   187 FDPSLLCA-GTYGRTACHGDSGGPLVVNKQ------LVGVVSWGRKGCVSSA---FFVSVPYFRE 241
            ...:.:|| |...:..|.|:|||||:  :|      |:||.|:|.:.|.:..   .:.:|..:.:
Mosquito   239 LKQTHMCAGGVRSKDTCSGNSGGPLM--RQMTGSWYLIGVNSFGPRKCGTFGVPDVYTNVAEYVD 301

  Fly   242 WILNAI 247
            ||.:.|
Mosquito   302 WIKDNI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/260 (27%)
Tryp_SPc 27..243 CDD:238113 69/259 (27%)
AgaP_AGAP013487XP_003436426.1 Tryp_SPc 55..303 CDD:214473 70/260 (27%)
Tryp_SPc 59..306 CDD:238113 71/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.