DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and KLK11

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:288 Identity:72/288 - (25%)
Similarity:118/288 - (40%) Gaps:76/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            |:|||   |:.|.|. .|.|||.|........|||.:|......:||.::.:...::|||||.  
Human    38 LILLA---LATGLVG-GETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCL-- 96

  Fly    72 EEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIH-------------------EEY---AFDLN 114
            :....|..   .......|:.||..|..::..|:|                   |.:   .|:.:
Human    97 KPWVSLTS---PTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNS 158

  Fly   115 I------NDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWG-----------------V 156
            :      |||.:|::::|:..|..|:|:.|:.......:..|:||||                 :
Human   159 LPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANI 223

  Fly   157 SYILNDS-TNLYPTHLQGLALHIKSIFSCRLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQLVG 218
            :.|.:.. .|.||.::                ..:::||...  |:.:|.||||||||.|:.|.|
Human   224 TIIEHQKCENAYPGNI----------------TDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQG 272

  Fly   219 VVSWGRKGCV---SSAFFVSVPYFREWI 243
            ::|||:..|.   ....:..|..:.:||
Human   273 IISWGQDPCAITRKPGVYTKVCKYVDWI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 62/267 (23%)
Tryp_SPc 27..243 CDD:238113 61/266 (23%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 62/267 (23%)
Tryp_SPc 54..303 CDD:238113 63/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.