DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and PRSS21

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:287 Identity:95/287 - (33%)
Similarity:131/287 - (45%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALDFLSAGQVNRWEQ----------------RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSI 56
            |||||....||......|                ||:|||...:.:.|||.||:.:..||||.|:
Human     7 LLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSL 71

  Fly    57 YSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNG--------TLVDVAALIIHEEYAFDL 113
            .|....:||||| |:...:..|..|:.|:.|. ||....        |...|:.:.:...|..: 
Human    72 LSHRWALTAAHC-FETYSDLSDPSGWMVQFGQ-LTSMPSFWSLQAYYTRYFVSNIYLSPRYLGN- 133

  Fly   114 NINDIAIVRLSTPLEFTSKVQPIPL-AKTNPYP-RSIALVSGWGVSYILNDSTNLYPTHLQGLA- 175
            :..|||:|:||.|:.:|..:|||.| |.|..:. |:...|:|||  ||..|.....|..||.:. 
Human   134 SPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWG--YIKEDEALPSPHTLQEVQV 196

  Fly   176 ----------LHIKSIFSCRLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQ----LVGVVSWGR 224
                      |.:|..|...:|. .::|||..  |:.||.|||||||..||.    .:|||||| 
Human   197 AIINNSMCNHLFLKYSFRKDIFG-DMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWG- 259

  Fly   225 KGC---VSSAFFVSVPYFREWILNAIA 248
            .||   .....:.::.:..|||...:|
Human   260 VGCGRPNRPGVYTNISHHFEWIQKLMA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 84/246 (34%)
Tryp_SPc 27..243 CDD:238113 83/245 (34%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 85/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.