DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss48

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:284 Identity:90/284 - (31%)
Similarity:140/284 - (49%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQ--------------RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIY 57
            |::|.|..|.|.|.:..:|              ||:||:...:...||||||::...|:||||:.
  Rat     6 LMVLLLLLLGAYQGSLTKQKKLQSVCGRPVYSGRIVGGQGAALGHWPWQVSLRFDSTHICGGSLI 70

  Fly    58 SENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTD--SNGTLVDVAALIIHEEYAFDLNIN-DIA 119
            |.:.::|||||......:.|    |.|..||...|  |.|....|:.::|..::.   |.: |||
  Rat    71 SNHWVMTAAHCIKKTWFSFL----YSVWLGSIDRDYSSTGEEYYVSRIVIPSKHH---NTDGDIA 128

  Fly   120 IVRLSTPLEFTSKVQPIPL---AKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSI 181
            :::||:.:.|||.|.||.|   :|....|.| ..|:|||     .:....||:.||.|.:.|.:.
  Rat   129 LLKLSSRVTFTSLVLPICLPNISKPLTVPAS-CWVTGWG-----QNQEGHYPSTLQELEVPIITG 187

  Fly   182 FSC-RLFDP--------------SLLCAG--TYGRTACHGDSGGPLVVNKQ----LVGVVSWGRK 225
            .:| :|::|              .:||||  ...:.:|.|||||||..:..    .:||:|||.:
  Rat   188 EACEQLYNPIGFFLPDLERIIKEDMLCAGEIQQSKDSCKGDSGGPLSCHIDGVWTQIGVISWGLE 252

  Fly   226 -GCVSSAFFVSVPYFREWILNAIA 248
             |......:.:|.|:::||.:.|:
  Rat   253 CGKNLPGVYTNVTYYQKWISSIIS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 80/244 (33%)
Tryp_SPc 27..243 CDD:238113 79/243 (33%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.