DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC102554637

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:240 Identity:80/240 - (33%)
Similarity:123/240 - (51%) Gaps:31/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88
            :.:|:||.......||:||||. .|.|.||||:.::..:|:||||:......||.:....|..| 
  Rat    21 DDKIVGGYTCQEHSVPYQVSLN-SGYHYCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEG- 83

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFD---LNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL 150
                 :...|:.|.:|.|..  ||   || |||.:::||:|::..::|..:.|..:.....:..|
  Rat    84 -----DEQFVNAAKIIKHPN--FDRKTLN-NDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCL 140

  Fly   151 VSGWG--VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLCAGTY--GRTACHGDS 206
            :||||  :|:.:||     |..||.|...:.....|....|     :::|||..  |:.:|.|||
  Rat   141 ISGWGNTLSFGVND-----PDLLQCLDAPLLPQADCEASYPGKITNNMVCAGFLEGGKDSCQGDS 200

  Fly   207 GGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIA 248
            |||:|.|.:|.|:|||| .||.   :...:..|..:.:||.:.||
  Rat   201 GGPVVCNGELQGIVSWG-YGCALPDNPGVYTKVCNYVDWIQDTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/231 (33%)
Tryp_SPc 27..243 CDD:238113 76/230 (33%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.