DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC101732176

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:265 Identity:87/265 - (32%)
Similarity:128/265 - (48%) Gaps:46/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSL-QYFGD--HVCGGSIYSENIIVTAAHCFF 70
            :::|..::.|...:.:.||:||........|||:|| :..|.  ::|||||.:...|||||||.:
 Frog   259 MVSLRCINCGLSTKVDNRIVGGTFALAGDWPWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCVY 323

  Fly    71 DEEGNRLDDQGYQVRAGSALTDSN----GTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTS 131
               |.......::|.||| ||.||    |.|||  .::||..|:.:....|||:::|.|.|.|::
 Frog   324 ---GYTSSPSIFKVFAGS-LTLSNYYSAGYLVD--RVLIHPSYSPNTQNYDIALLKLKTALVFST 382

  Fly   132 KVQPI-------PLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL--- 186
            .::|:       |.|...|     ..:||||.:    .......|.|:..::.|.|..:|.|   
 Frog   383 NLRPVCLPNVGMPWADGQP-----CWISGWGTT----SEAGSISTSLKAASVPIISSATCNLAPV 438

  Fly   187 ----FDPSLLCAGTY--GRTACHGDSGGPLVVNKQ----LVGVVSWGRKGCVSS---AFFVSVPY 238
                ..|:::|||..  |...|.||||||||....    |||..||| .||..:   ..:.::..
 Frog   439 YGGVISPTMICAGYLGGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWG-YGCARAYKPGVYGNITV 502

  Fly   239 FREWI 243
            |.|||
 Frog   503 FLEWI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 83/246 (34%)
Tryp_SPc 27..243 CDD:238113 82/245 (33%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 2/11 (18%)
Tryp_SPc 277..510 CDD:238113 84/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.