DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC101730924

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:257 Identity:84/257 - (32%)
Similarity:126/257 - (49%) Gaps:31/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            ||||.:...:|...:  :.:||||.......||:.|||. .|.|.||||:.:...:|:||||:  
 Frog     3 LLLLCVLLGAAAAFD--DDKIIGGATCAKNSVPYIVSLN-SGYHFCGGSLINNQWVVSAAHCY-- 62

  Fly    72 EEGNRLDDQGYQVRAGS---ALTDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSK 132
                   ....|||.|.   ||::.....:..:.:|.|..| ::.|: |||.:::||:.....:.
 Frog    63 -------KASIQVRLGEHNIALSEGTEQFISSSKVIRHSGYNSWTLD-NDIMLIKLSSAASLNAA 119

  Fly   133 VQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLL 192
            |..:.|........:..|:||||.:  |:..:| ||..||.|...|.:...|....|     :::
 Frog   120 VNAVALPSGCAAAGTSCLISGWGNT--LSSGSN-YPDLLQCLYAPILTDAQCNNAYPGEITNNMI 181

  Fly   193 CAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIAS 249
            |.|..  |:.:|.||||||:|.|.||.|||||| .||....:   :..|..:..||.:.||:
 Frog   182 CLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWG-YGCAQRNYPGVYTKVCNYNSWIQSTIAA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/230 (33%)
Tryp_SPc 27..243 CDD:238113 75/229 (33%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.