DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss50

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017451624.2 Gene:Prss50 / 100910205 RGDID:6499372 Length:424 Species:Rattus norvegicus


Alignment Length:245 Identity:70/245 - (28%)
Similarity:110/245 - (44%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSA---LTDSNGTLVDV 100
            ||.||:|..|.|||.|.:.:...::..|||.   ..||::   |.||.||.   .|....:.|.|
  Rat   164 PWMVSVQTNGSHVCAGILIASQWVLAVAHCL---SQNRVN---YTVRVGSPWINQTTETSSDVPV 222

  Fly   101 AALIIHEEY------AFDLNINDIAIVRLSTPLEFTSKVQPI--PLAKTNPYPRSIALVSGWGVS 157
            ..:||:..|      ::...|:||.:::|...|:::..|.|:  |..:......|:..|:|||..
  Rat   223 NQVIINSGYQSKRYWSWVGRIHDIGLLKLKWGLKYSKYVWPVCLPGLEYVVEDGSLCTVTGWGYP 287

  Fly   158 YILNDSTNLYPTH--LQGLALHIKSIFSC--------------RLFDPSLLCAGTYGRTA-CHGD 205
                .:..|:|..  ||...:.|.:...|              |:..|.::||....|.. |:..
  Rat   288 ----KANGLWPQFQTLQEKEVSILNSRECEHYYHKFSRIHSLVRIISPQMICALDNDREKFCYER 348

  Fly   206 SGGPLVVNKQ----LVGVVSWGRKGCVSS---AFFVSVPYFREWILNAIA 248
            ||.|||.:..    ||||:||| .||..|   ..|:.|.:::.||.:.::
  Rat   349 SGEPLVCSSDGMWYLVGVMSWG-PGCKKSEAPPIFLQVSHYQLWIWDRLS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 68/238 (29%)
Tryp_SPc 27..243 CDD:238113 68/238 (29%)
Prss50XP_017451624.2 Tryp_SPc 162..392 CDD:238113 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.