DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and prss59.2

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:256 Identity:81/256 - (31%)
Similarity:119/256 - (46%) Gaps:36/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLL----ALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAA 66
            ||:||    |||          :.:|:||........|||.||. .|.|.||||:.||..:|:||
Zfish     6 FLVLLGAAFALD----------DDKIVGGYECQPNSQPWQASLN-SGYHFCGGSLVSEYWVVSAA 59

  Fly    67 HCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTS 131
            ||:......||.:....:..|   |:...|...|.....::.:..|   :||.:::||.|.....
Zfish    60 HCYKSRLEVRLGEHNIVINEG---TEQFITSEKVIRNPNYDSWTID---SDIMLIKLSKPATLNK 118

  Fly   132 KVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR-----LFDPSL 191
            .|||:.|........::..|||||.:......:|    .||.|.:.|.|...|:     :...::
Zfish   119 YVQPVALPNGCAADGTMCRVSGWGNTMSSTADSN----KLQCLEIPILSDRDCKNSYPGMITDTM 179

  Fly   192 LCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAI 247
            .|||..  |:.:|.||||||:|.|.:|.|:|||| .||.   :...:..|..|.:||.:.:
Zfish   180 FCAGYLEGGKDSCQGDSGGPVVCNGELQGIVSWG-YGCAQKDNPGVYGKVCMFSQWIADTM 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 72/226 (32%)
Tryp_SPc 27..243 CDD:238113 72/225 (32%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 72/226 (32%)
Tryp_SPc 21..238 CDD:238113 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.