DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC100498532

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:252 Identity:83/252 - (32%)
Similarity:129/252 - (51%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDE 72
            :|:.|...:|..::..:.:|:||........||||...|.|.:.||||:.|...|::||||:...
 Frog     6 VLMFLAVAAAAPLDDDDDKIVGGYECTPHSQPWQVLFTYNGGNWCGGSLISPRWIISAAHCYQPP 70

  Fly    73 EG--NRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQP 135
            :.  ..|.:...:.:.|   |:.:   :.|.|...|..|....:.:||.:|:|:.|.::...|||
 Frog    71 KTLVALLGEHDLKKKEG---TEQH---IQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQYNQYVQP 129

  Fly   136 IPLAKTNPYPRSIALVSGWG--VSYILNDSTNLYPTHLQGLALHIKSIFSC-----RLFDPSLLC 193
            ||:|::.|...:..||||:|  :.|.:.     ||..||.|.:.|.|..||     |:...::.|
 Frog   130 IPVARSCPTDGAKCLVSGFGNVLGYNVR-----YPDQLQCLEVPIVSDSSCKASYPRMISENMFC 189

  Fly   194 AGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSS---AFFVSVPYFREWILN 245
            ||..  |:.:|||||||||:.|.:|.|.||||...|:|.   ..:..|..:.:||.|
 Frog   190 AGFLEGGKGSCHGDSGGPLICNGELYGAVSWGGSYCISKNSPGVYAKVCNYLDWIKN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/230 (33%)
Tryp_SPc 27..243 CDD:238113 77/229 (34%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.