DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and tmprss2.12

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:266 Identity:85/266 - (31%)
Similarity:129/266 - (48%) Gaps:48/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDE 72
            |:::|..:..|.....|.||:||....|...||||:|||...::||||:.:.|.|||||||.   
 Frog   242 LVVSLKCIDCGLSTYGESRIVGGSSASIGDWPWQVNLQYDDTNLCGGSVIAANWIVTAAHCV--- 303

  Fly    73 EGNRLDDQGYQVRAGS----ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKV 133
            :|:......::...|.    :..||:...||  .:|:|.:|:...|.||||:::|.|.:.|:|..
 Frog   304 QGDTSSPSLWKAFIGKIKMPSYYDSSAYSVD--RIIVHPDYSSQTNSNDIALMKLKTSIAFSSIS 366

  Fly   134 QPIPL-------AKTNPYPRSIALVSGWG-------VSYILNDS--TNLYPTHLQGLALHIKSIF 182
            :|:.|       .:..|     ..:||||       :|.:|..:  ..:.||......::..:|.
 Frog   367 RPVCLPNYGMQWEEGQP-----CYISGWGTTSQKGSISSVLKYAMVPLISPTTCNQTIMYNGAIT 426

  Fly   183 SCRLFDPSLLCAGTY---GRTACHGDSGGPLVVNKQ----LVGVVSWGRKGCVS---SAFFVSVP 237
            |      |::||| |   |..:|.||||||||....    |||..||| .||.:   ...:.::.
 Frog   427 S------SMICAG-YPKGGVDSCQGDSGGPLVTKTNSLWWLVGDTSWG-DGCANVYRPGVYGNMT 483

  Fly   238 YFREWI 243
            .|.:||
 Frog   484 VFLQWI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 79/246 (32%)
Tryp_SPc 27..243 CDD:238113 78/245 (32%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055 3/12 (25%)
Tryp_SPc 261..489 CDD:238113 78/245 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.