DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and f12

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:249 Identity:82/249 - (32%)
Similarity:113/249 - (45%) Gaps:45/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ||:||........|:..:| |..:|.||||:.|...|||||||        ||.:....:....|
 Frog   358 RIVGGLVALPASHPYIAAL-YIDNHFCGGSLISPCWIVTAAHC--------LDQRPNVTKISVVL 413

  Fly    91 -------TDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLST-----PLEFTSKVQPIPLAKTNP 143
                   ||.:...:.|...|:||:|..|...:|||:|::.:     ..||:..||||.|.:...
 Frog   414 GQSRFNTTDQHTVTLLVEKYILHEKYYGDTLQHDIALVKVKSINGLCASEFSQFVQPICLPQQFK 478

  Fly   144 YPRSI--ALVSGWGVSYILNDSTNLYPTHLQGLALHI--------KSIFSCRLFDPSLLCAGTY- 197
            ...|.  .:|:|||..|   :....|...||..::.|        .|:...|:. |.:||||.. 
 Frog   479 MAESTKQCVVAGWGHQY---EGAEHYAFFLQEASMPIIPYTQCQSPSVHGDRML-PGMLCAGFME 539

  Fly   198 -GRTACHGDSGGPLVVNK----QLVGVVSWGRKGCVSS---AFFVSVPYFREWI 243
             |..||.||||||||...    :|.|||||| .||...   ..:.:|..:.:||
 Frog   540 GGVDACQGDSGGPLVCEVDGRIELHGVVSWG-SGCAEENKPGVYTAVTSYTDWI 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 80/247 (32%)
Tryp_SPc 27..243 CDD:238113 79/246 (32%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 81/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.