DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC100490788

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001333500.1 Gene:LOC100490788 / 100490788 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:235 Identity:78/235 - (33%)
Similarity:121/235 - (51%) Gaps:24/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEG--NRLDDQGYQVRA 86
            :.:|:||........||||...:.|.:.||||:.|...|::||||:...:.  ..|.:...:.:.
 Frog    21 DDKIVGGYECTPHSQPWQVFFTFNGRNWCGGSLISPRWIISAAHCYQPPKTLVALLGEHDLKKKE 85

  Fly    87 GSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALV 151
            |   |:.:   :.|.|...|..|..:...:||.:|:|:.|.::...|||||:|::.|...:..||
 Frog    86 G---TEQH---IQVEAAYKHFGYKDEAYDHDIMLVKLAKPAQYNQYVQPIPVARSCPTDGAKCLV 144

  Fly   152 SGWG--VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLCAGTY--GRTACHGDSG 207
            ||:|  ::|.:.     ||..||.|.|.|.|..||:...|     ::.|||..  .:.:|.||||
 Frog   145 SGYGNLLAYNIR-----YPDQLQCLDLPILSDSSCKASYPRQISENMFCAGFLEGEKDSCQGDSG 204

  Fly   208 GPLVVNKQLVGVVSWGRKGCVSSA--FFVSVPYFREWILN 245
            |||:.:.:|.|||||||.....:|  .:..|..:.:||.|
 Frog   205 GPLICSGELYGVVSWGRYCARKNAPGVYAKVCNYLDWIKN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/229 (33%)
Tryp_SPc 27..243 CDD:238113 75/228 (33%)
LOC100490788NP_001333500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.