DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and zfand4

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_012822294.1 Gene:zfand4 / 100144290 XenbaseID:XB-GENE-6258311 Length:701 Species:Xenopus tropicalis


Alignment Length:229 Identity:42/229 - (18%)
Similarity:78/229 - (34%) Gaps:97/229 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GEPIGIEQVPWQVSLQYFGDHV---------CGGSIYSENIIVTAAHCFFDEEGNRLD-----DQ 80
            |.||...:||.:..::...:::         .|.|......:|.       .||.:|:     |:
 Frog   102 GGPINTRRVPLEDPIREIAEYMDPIREDLWEKGSSNKQVTFLVY-------REGEQLNFFRVVDR 159

  Fly    81 GYQVRAGSALTDSNGTLVDVAALI----IHEEYAFD-----------------LNINDIAIVRLS 124
            |            :|||..::..:    ::..||.|                 :.:|.:.:::  
 Frog   160 G------------DGTLTPLSESLSGASVYNLYAEDEDEAEGSPSGQHIIENAITMNKMKLLK-- 210

  Fly   125 TPLEFTSKVQ-------PIPLAKTNPYP----------------RSIALVSGWGVSYIL--NDST 164
                  ||::       |..:||..|.|                |.:.::...|.||:.  |..:
 Frog   211 ------SKMENMNLNKKPKKMAKLKPRPPMIPRPTSGLMSSSRHRLLRVLPHIGQSYLPPGNSLS 269

  Fly   165 NLYP-THLQGLALHIKSIFSCRLFDPSLLCAGTY 197
            :..| |.|..:|...::|       ||:  ||.|
 Frog   270 SESPHTALSAIAAATRTI-------PSI--AGDY 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 42/229 (18%)
Tryp_SPc 27..243 CDD:238113 42/229 (18%)
zfand4XP_012822294.1 Ubl_ZFAND4 28..101 CDD:340500
ZnF_AN1 641..679 CDD:197545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.