DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and gzma

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:238 Identity:62/238 - (26%)
Similarity:106/238 - (44%) Gaps:32/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IESFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAH 67
            :.|.|||:.::    |.:.   ..||.|........|:...: |.....|||::..:|.::||||
 Frog    18 LSSILLLIHIN----GNIC---MDIIDGREAASHSRPYMAYI-YSRTGSCGGTLIKQNWVLTAAH 74

  Fly    68 CFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRL--STPLEFT 130
            |..:.....|.  .::|::    .::......||..|.|..:.:...|:||.::::  :..|...
 Frog    75 CVVNNSEVILG--AHKVKS----RENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKF 133

  Fly   131 SKVQPIPLAKTNPYPRSIALVSGWGV--------SYILNDSTNLYPTHLQGLALHIKSIFSCRLF 187
            ..|..:|....:..|.|....:||||        |.:|.: .|:.... :|....|...|...: 
 Frog   134 VSVLKLPTTDMDVKPGSSCSTAGWGVTKPNGKTPSDVLRE-VNVTVVD-RGTCNKIYKKFKTEI- 195

  Fly   188 DPSLLCAGTYGRT-----ACHGDSGGPLVVNKQLVGVVSWGRK 225
            ..::||||...::     ||.|||||||:..|:..|:||:|:|
 Frog   196 STNMLCAGAPKKSDKKYDACQGDSGGPLICGKEFSGIVSFGKK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 57/215 (27%)
Tryp_SPc 27..243 CDD:238113 57/214 (27%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 57/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.