DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Prss36

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:257 Identity:80/257 - (31%)
Similarity:120/257 - (46%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PE---RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRET----EFLSVRV 78
            ||   |||||......:.|||.|:.:.|...||.::.:...|::||||.....|    :.|||.:
Mouse    42 PEPSSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLL 106

  Fly    79 G---SSFTFFGGQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSKLRLGSAVS--VIPLADTPPASG 137
            |   ......|..:..|:::|:.:.|.. ....|:|::||.|..:||.:|.  .:|.|....|.|
Mouse   107 GVHSQDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCLPRASHLFAHG 171

  Fly   138 SPATVSGWGAIGFKKNYPMSILSASVD--IVDQDQCRRSYGR--------KITKDMICAAAPG-- 190
            :....:|||.:......|:..:...|:  ::.:..|:..|.|        ::...|:||..|.  
Mouse   172 TACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGYPAGR 236

  Fly   191 KDACSGDSGGPLV--SGNK--LVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERITKSE 248
            :|.|.||||||||  .|.:  |.||.|||..|.....|||:..||..:.||.   |.:..||
Mouse   237 RDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESWIR---EHVMGSE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 73/239 (31%)
Tryp_SPc 24..237 CDD:238113 72/238 (30%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 74/244 (30%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.