DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and LOC683849

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:223 Identity:80/223 - (35%)
Similarity:122/223 - (54%) Gaps:12/223 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGS-SFTFF 85
            ::||||......|||:|.| |..|...||.::.::..|::||||...|    :.||:|. :....
  Rat    22 DKIVGGYTCQENSVPYQVS-LNSGYHFCGGSLINDQWVVSAAHCYKSR----IQVRLGEHNINVL 81

  Fly    86 GG--QVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWG- 146
            .|  |.|..:.::.|..:| ::.:|||.:::|.|.::|.:.|:.:.|..:...:|:...:|||| 
  Rat    82 EGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGN 146

  Fly   147 AIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAA--APGKDACSGDSGGPLVSGNKLV 209
            .:.|..|.|..:......::.|..|..||..|||.:|:||.  ..|||:|.||||||:|...:|.
  Rat   147 TLSFGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCAGFLEGGKDSCQGDSGGPVVCNGELQ 211

  Fly   210 GIVSFGKECAHPEYPGVYANVAELKPWI 237
            ||||:|..||.|:.||||..|.....||
  Rat   212 GIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 78/220 (35%)
Tryp_SPc 24..237 CDD:238113 78/219 (36%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 78/220 (35%)
Tryp_SPc 24..242 CDD:238113 80/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.