DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and prss1

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:223 Identity:80/223 - (35%)
Similarity:117/223 - (52%) Gaps:12/223 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGS---SFT 83
            ::||||...|...||:|.| |..|...||.::.|...|::||||...|    :.||:|.   ..|
Zfish    23 DKIVGGYECTKNGVPYQVS-LNSGYHFCGGSLISNLWVVSAAHCYKSR----VQVRLGEHNIDVT 82

  Fly    84 FFGGQVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGA 147
            ....|.:....|:.|..|: .:..||:.:::|.|..::.|.|..:.|..:..:||:...:||||.
Zfish    83 EGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQINSYVKTVSLPSSCASSGTSCLISGWGN 147

  Fly   148 IGFK-KNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAA--APGKDACSGDSGGPLVSGNKLV 209
            :... .|||..::..:..|:....||.:|..:|:.:|.||.  ..|||:|.||||||:|..|:|.
Zfish   148 MSASGSNYPSRLMCLNAPILSDSTCRNAYPGQISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQ 212

  Fly   210 GIVSFGKECAHPEYPGVYANVAELKPWI 237
            ||||:|..||....|||||.|.....||
Zfish   213 GIVSWGYGCAQRNKPGVYAKVCNFTTWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 78/220 (35%)
Tryp_SPc 24..237 CDD:238113 78/219 (36%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 78/220 (35%)
Tryp_SPc 25..243 CDD:238113 80/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.