DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG17234

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:259 Identity:99/259 - (38%)
Similarity:140/259 - (54%) Gaps:24/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVQWIFLAFSVTVVSSNWI---PERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITA 62
            ||::...|..::..:|:..:   .:||:||:.|.|..||||.|:...|...||.:||||:|::||
  Fly     1 MFIESFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTA 65

  Fly    63 AHCLTDRETEFL-----SVRVGSSFTFFGGQVVRVSSVLLHEEYDQSWS-NDIAVMRLQSKLRLG 121
            |||..|.|...|     .||.||:.|...|.:|.|:::::||||....: ||||::||.:.|...
  Fly    66 AHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFT 130

  Fly   122 SAVSVIPLADTPPASGSPATVSGWGAIGFKKN-----YPMSILSASVDIVDQDQCRRSYGRKITK 181
            |.|..||||.|.|...|.|.||||| :.:..|     ||..:...::.|.....|     |....
  Fly   131 SKVQPIPLAKTNPYPRSIALVSGWG-VSYILNDSTNLYPTHLQGLALHIKSIFSC-----RLFDP 189

  Fly   182 DMICAAAPGKDACSGDSGGPLVSGNKLVGIVSFG-KECAHPEYPGVYANVAELKPWILGAIERI 244
            .::||...|:.||.||||||||...:|||:||:| |.|....:   :.:|...:.|||.||..|
  Fly   190 SLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIASI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 89/225 (40%)
Tryp_SPc 24..237 CDD:238113 88/224 (39%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 89/225 (40%)
Tryp_SPc 27..243 CDD:238113 88/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443135
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.