DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG34458

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:244 Identity:82/244 - (33%)
Similarity:125/244 - (51%) Gaps:9/244 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQWIFLAFSVTVVSSNW-IPE--RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAH 64
            |:...|..:||.|.|:. :.|  ||:||........|.|.|:...||.|||.::.|:.:::||||
  Fly     8 VKLSILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAH 72

  Fly    65 CLTDRETEFLSVRVGSSFTFFG-GQVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVI 127
            |...:....:...||::....| ||...::..::|..|: ||...|:::::|.|.:.:|.||..|
  Fly    73 CTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTI 137

  Fly   128 PLADTPP--ASGSPATVSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAPG 190
            .|||:..  |:.:.|.:||:|||......|..:..|.|.:..:|.|.......:|..|:||..|.
  Fly   138 QLADSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPGLTDRMVCAGHPS 202

  Fly   191 --KDACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWI 237
              ..:|.|||||||....||.|:||:|..|.....|.:|..|..|:.||
  Fly   203 GQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 73/219 (33%)
Tryp_SPc 24..237 CDD:238113 72/218 (33%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 73/219 (33%)
Tryp_SPc 32..254 CDD:238113 74/220 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452421
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.