DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and PRTN3

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:241 Identity:70/241 - (29%)
Similarity:99/241 - (41%) Gaps:38/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IVGGDLITILSVPWQASILRLGR---FHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFF 85
            ||||......|.|:.||:...|.   ..||..:.....|:||||||.|.....::|       ..
Human    28 IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNV-------VL 85

  Fly    86 GGQVVR----------VSSVLLHEEYDQSWSNDIAVMRLQSKLRLGSAVSVI--PLADTPPASGS 138
            |...||          |:.|.|:....::..||:.:::|.|...|.::|:.:  |..|.|...|:
Human    86 GAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT 150

  Fly   139 PATVSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAPGKDA--CSGDSGGP 201
            .....|||.:| ..:.|..:|......|....||        ...||...|.:.|  |.||||||
Human   151 QCLAMGWGRVG-AHDPPAQVLQELNVTVVTFFCR--------PHNICTFVPRRKAGICFGDSGGP 206

  Fly   202 LVSGNKLVGIVSF---GKECAHPEYPGVYANVAELKPWILGAIERI 244
            |:....:.||.||   |  ||...:|..:..||....||...:.|:
Human   207 LICDGIIQGIDSFVIWG--CATRLFPDFFTRVALYVDWIRSTLRRV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 67/232 (29%)
Tryp_SPc 24..237 CDD:238113 67/232 (29%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.