DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and KLK10

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:218 Identity:66/218 - (30%)
Similarity:101/218 - (46%) Gaps:18/218 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFF--GGQVVRVSSVL 96
            |.|||.|:.....|||...:..:..|:|||||    ..:.|..|||......  |.|:.|.:..:
Human    56 SQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHC----GNKPLWARVGDDHLLLLQGEQLRRTTRSV 116

  Fly    97 LHEEYDQ---------SWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGFKK 152
            :|.:|.|         :..:|:.:::|...:.||..|..:.|.......|....|:|||....::
Human   117 VHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARR 181

  Fly   153 -NYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAP-GKDACSGDSGGPLVSGNKLVGIVSFG 215
             .|...:..:|:.|:...:|...|...:|.:||||... |:|.|..|||||||....|.||:|:|
Human   182 VKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWG 246

  Fly   216 -KECAHPEYPGVYANVAELKPWI 237
             ..|...::|.||..:.:...||
Human   247 VYPCGSAQHPAVYTQICKYMSWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 64/216 (30%)
Tryp_SPc 24..237 CDD:238113 64/216 (30%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 66/218 (30%)
Tryp_SPc 49..269 CDD:214473 64/216 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.