DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Klk11

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:226 Identity:72/226 - (31%)
Similarity:115/226 - (50%) Gaps:14/226 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFGG 87
            ||:.|......|.|||.::.:..|..|||.:.:...::|||||   |:..::.:....:.....|
Mouse    47 RIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHC---RKPHYVILLGEHNLEKTDG 108

  Fly    88 --QVVRVSSVLLHEEYDQS-----WSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGW 145
              |....:....|.:::.|     ..|||.::::.|.:....||..:.|:....|:|:...:|||
Mouse   109 CEQRRMATESFPHPDFNNSLPNKDHRNDIMLVKMSSPVFFTRAVQPLTLSPHCVAAGTSCLISGW 173

  Fly   146 GAIGFKK-NYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAA--PGKDACSGDSGGPLVSGNK 207
            |.....: ..|.|:..|:|.|::..:|.::|...||..|:||:.  .|||:|.||||||||....
Mouse   174 GTTSSPQLRLPHSLRCANVSIIEHKECEKAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGS 238

  Fly   208 LVGIVSFGKE-CAHPEYPGVYANVAELKPWI 237
            |.||:|:|:: ||....||||..|.:...||
Mouse   239 LQGIISWGQDPCAVTRKPGVYTKVCKYFNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 70/224 (31%)
Tryp_SPc 24..237 CDD:238113 69/223 (31%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 70/224 (31%)
Tryp_SPc 48..272 CDD:238113 71/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.