DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:233 Identity:78/233 - (33%)
Similarity:123/233 - (52%) Gaps:13/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVG----SSF 82
            :||:||..:...|:.:|||:......:||..:.....|::||||.  |.:..:.|.:.    |..
Zfish    22 QRIIGGQEVQPYSIKYQASVQYNNYHYCGGTLIHPQWVVSAAHCW--RPSYLIKVVLSEHDLSKI 84

  Fly    83 TFFGGQVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAV--SVIPLADTPPASGSPATVSG 144
            ..| .:|..||..|:|..|: :::.:||.:::|:....|.:.:  :|:|::......|:...|||
Zfish    85 EGF-ERVFNVSKALVHYMYNYRTFDSDIMLLKLEKPAELSATIQPAVLPVSVPALQGGTVCIVSG 148

  Fly   145 WGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAP--GKDACSGDSGGPLVSGNK 207
            ||.......|...:|.| ||:....||:..|..:||.:|:||.:|  |||:|.|||||||:....
Zfish   149 WGVTQVYSYYLSPVLRA-VDVQIIPQCQYYYYYRITDNMVCAGSPLGGKDSCQGDSGGPLICNGY 212

  Fly   208 LVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERIT 245
            ..||||:|..||:..:||||..|....||:...|:..|
Zfish   213 FEGIVSWGISCANAYFPGVYTKVRNYIPWMTWIIDNDT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 75/222 (34%)
Tryp_SPc 24..237 CDD:238113 74/221 (33%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 74/221 (33%)
Tryp_SPc 24..241 CDD:238113 73/220 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.