DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Elane

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:242 Identity:72/242 - (29%)
Similarity:104/242 - (42%) Gaps:48/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTF 84
            :...||||......:.|:.||:.|.|...|||.:.:.:.|::||||:..  ..|.||:|      
Mouse    25 LASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNG--LNFRSVQV------ 81

  Fly    85 FGGQVVRVSSVLLHEEYDQSWS---------------NDIAVMRLQSKLRLGSAVSVIPLADTPP 134
                |:....:...|...|::|               |||.:::|.....:.:.|.|..|    |
Mouse    82 ----VLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQL----P 138

  Fly   135 ASG------SPATVSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAPGKDA 193
            |.|      :|....|||.:|..:..|..:...:|.:| .:.|||...       :|...|.:.|
Mouse   139 AQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVV-TNMCRRRVN-------VCTLVPRRQA 195

  Fly   194 --CSGDSGGPLVSGNKLVGIVSFGK-ECAHPEYPGVYANVAELKPWI 237
              |.||||||||..|.:.||.||.: .|....||..:|.|||...||
Mouse   196 GICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 70/237 (30%)
Tryp_SPc 24..237 CDD:238113 70/236 (30%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 70/237 (30%)
Tryp_SPc 29..245 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.