DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Prss36

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:257 Identity:79/257 - (30%)
Similarity:119/257 - (46%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PE---RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRET----EFLSVRV 78
            ||   |||||......:.|||.|:...|...||.::.:...|::||||.....|    :..||.:
  Rat    53 PEPSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLL 117

  Fly    79 G---SSFTFFGGQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSKLRLGSAVS--VIPLADTPPASG 137
            |   ......|..:..|:::|:.:.|.: ....|:|::||.|..:||.:|.  .:|.|....|.|
  Rat   118 GVHSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRASHLFAHG 182

  Fly   138 SPATVSGWGAIGFKKNYPMSILSASVD--IVDQDQCRRSYGR--------KITKDMICAAAP--G 190
            :....:|||.:......|:..:...|:  ::.:..|:..|.|        ::...|:||..|  .
  Rat   183 TACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGYPEGR 247

  Fly   191 KDACSGDSGGPLV--SGNK--LVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERITKSE 248
            :|.|.||||||||  .|.:  |.||.|||..|.....|||:..||..:.||.   |.:..||
  Rat   248 RDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWIR---EHVMGSE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 72/239 (30%)
Tryp_SPc 24..237 CDD:238113 71/238 (30%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 73/244 (30%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.