DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and epsilonTry

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:227 Identity:106/227 - (46%)
Similarity:141/227 - (62%) Gaps:5/227 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFGG 87
            |||||...:|.:.|:|.|:.|.|...||.:|||.||||||||||...|.:.|.:||||::...||
  Fly    30 RIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWRSGG 94

  Fly    88 QVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAI-GF 150
            .|..|.|...||.|: ::..||||::|::|.|...|::..|.:||:.|..|:.|.|||||.. ..
  Fly    95 SVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESG 159

  Fly   151 KKNYPMSILSASVDIVDQDQCRR---SYGRKITKDMICAAAPGKDACSGDSGGPLVSGNKLVGIV 212
            ....|..:|:..::|:|..:||.   .||:||...|:||.||.||||.||||||||||::|||:|
  Fly   160 GSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAPHKDACQGDSGGPLVSGDRLVGVV 224

  Fly   213 SFGKECAHPEYPGVYANVAELKPWILGAIERI 244
            |:|..|....||||||:||....||....|.:
  Fly   225 SWGYGCGDVRYPGVYADVAHFHEWIERTAEEV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 103/218 (47%)
Tryp_SPc 24..237 CDD:238113 102/217 (47%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 103/218 (47%)
Tryp_SPc 31..252 CDD:238113 104/220 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452446
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.