DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and deltaTry

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:249 Identity:110/249 - (44%)
Similarity:149/249 - (59%) Gaps:13/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQWIFLAFSVTVVSSNWIPE--------RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIV 59
            ::::.|..:|.......:||        |||||...||.|.|||.|:.|.|...||.:|||.:::
  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66

  Fly    60 ITAAHCLTDRETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSA 123
            :||||||.......|.:|.|||:...||....|||...||.|: .:..||||::::...|...|.
  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131

  Fly   124 VSVIPLADTPPASGSPATVSGWGAIGF-KKNYPMSILSASVDIVDQDQCRRS---YGRKITKDMI 184
            :..|.||.:.||:|:.|:|||||.:.: ..:.|..:...:|:||.|.||..|   ||.:|...||
  Fly   132 IKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMI 196

  Fly   185 CAAAPGKDACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWIL 238
            ||||.|||||.||||||||||..|||:||:|..||:..||||||:||.|:.|::
  Fly   197 CAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 105/218 (48%)
Tryp_SPc 24..237 CDD:238113 104/217 (48%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 105/218 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443215
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.