DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and KLK12

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:235 Identity:78/235 - (33%)
Similarity:111/235 - (47%) Gaps:15/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRE 70
            |||...|..:|....| :|..|......|.|||..:.......||..:.....|:|||||...| 
Human     5 IFLLLCVLGLSQAATP-KIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSR- 67

  Fly    71 TEFLSVRVGS---SFTFFGGQVVRVSSVLLHEEY---DQSWSNDIAVMRLQSKLRLGSAVSVIPL 129
               ..||:|.   |...:..|:......:.|..|   ..|..:|:.::||:..:|:.|:|..:||
Human    68 ---YWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPL 129

  Fly   130 ADTPPASGSPATVSGWGAIGFKKN-YPMSILSASVDIVDQDQCRRSYGRKITKDMICA-AAPGKD 192
            .:....:|:...|||||.....:| :|..:...::.||....|...|..:||.:|:|| ..||:|
Human   130 PNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQD 194

  Fly   193 ACSGDSGGPLVSGNKLVGIVSFGK--ECAHPEYPGVYANV 230
            ||.||||||||.|..|.|:||:|.  .|.....||||..:
Human   195 ACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 72/218 (33%)
Tryp_SPc 24..237 CDD:238113 72/217 (33%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 72/218 (33%)
Tryp_SPc 22..236 CDD:238113 72/217 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.