DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG17477

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:105/253 - (41%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FSVTVVSSNW-----IPERIVGGDLITILSVPWQASI-LRLGRFHCGAAIYSEDIVITAAHCLTD 68
            |.:.|.||.:     :...||||........|:|.|: ..||...||.||.|:..:|||.||:..
  Fly     8 FYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKG 72

  Fly    69 RETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSKLRLGSAVSVIPLADT 132
            ..|..|.|..|:......|.|....::.||..||. .:.|||.::.|...:...:....:.|..:
  Fly    73 YPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTS 137

  Fly   133 P-PASGSPATVSGWGAIGFKKNYPM----------------SILSASVDIVDQDQCRRSYGRKIT 180
            | |...|....:|||:.....:.|.                |::||..|: :...|.        
  Fly   138 PFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDL-ELGPCH-------- 193

  Fly   181 KDMICAAAPGK-DACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWI 237
               |||..... .||.||||||||....||||::|...||. ..|.::.|:...:.|:
  Fly   194 ---ICAYRQANIGACHGDSGGPLVHQGTLVGILNFFVPCAQ-GVPDIFMNIMYYRDWM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 68/233 (29%)
Tryp_SPc 24..237 CDD:238113 68/232 (29%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 69/234 (29%)
Tryp_SPc 27..246 CDD:214473 68/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.