DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG12951

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:230 Identity:76/230 - (33%)
Similarity:115/230 - (50%) Gaps:16/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRL-GRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVG-SSFTFF 85
            |:|.|...::|..|:..|:... |...||.:|.|:..|:|||||...|..:.||::.| ::.:..
  Fly    29 RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAM 93

  Fly    86 GGQVVRVSSVLLHEEYD--QSWSNDIAVMRLQSKLRLGSAVSVIP-----LADTPPAS--GSPAT 141
            |..||.:..::.||::|  :..:|||:::.::..... ..|||.|     ||...|.|  |....
  Fly    94 GPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEF-DGVSVAPVELPALAFAVPQSDAGVEGV 157

  Fly   142 VSGWGAIGFKKNYPMSILSASVDIVDQDQC-RRSYGRKITKDMICAAAP--GKDACSGDSGGPLV 203
            :.|||......:...::...|:.|...::| .|..|:...|..||....  ||..|||||||||:
  Fly   158 LIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLI 222

  Fly   204 SGNKLVGIVSFG-KECAHPEYPGVYANVAELKPWI 237
            ...:.|||||:. |.|....|||||..|::...||
  Fly   223 YNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 74/228 (32%)
Tryp_SPc 24..237 CDD:238113 73/227 (32%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/228 (32%)
Tryp_SPc 30..260 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.