DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Klk4

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:247 Identity:76/247 - (30%)
Similarity:115/247 - (46%) Gaps:12/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WI--FLAFSVTVVSSNWIPERIVGGDLITILSVPWQASIL-RLGRFHCGAAIYSEDIVITAAHCL 66
            |.  :|...||..|::.|..||:.|......|.||||::. ....|.|...:.....|::||||:
  Rat    11 WFLGYLILEVTGSSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCI 75

  Fly    67 TDRETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEY-DQSWSNDIAVMRLQSKLRLGSAVSVIPLA 130
            .|..|..|.:.........|.:::.....:.|..| |.|::||:.:::|...:...:.:..||:|
  Rat    76 QDSYTVGLGLHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIRRIPVA 140

  Fly   131 DTPPASGSPATVSGWGAIGFKKN--YPMSILSASVDIVDQDQCRRSYGRKITKDMICAAA--PGK 191
            ...|..|....|||||.:   ||  .|..:...::.:..::.||..|.......|.||..  ..|
  Rat   141 SQCPTPGDTCLVSGWGRL---KNGKLPSLLQCVNLSVASEETCRLLYDPVYHLSMFCAGGGPDRK 202

  Fly   192 DACSGDSGGPLVSGNKLVGIVSFGK-ECAHPEYPGVYANVAELKPWILGAIE 242
            |.|:||||||:|....|.|:||.|: ||..|..|.||.|:.:...||...|:
  Rat   203 DTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWIWTTIQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 67/220 (30%)
Tryp_SPc 24..237 CDD:238113 66/219 (30%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 65/216 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.