DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG10587

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:241 Identity:83/241 - (34%)
Similarity:124/241 - (51%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLG-RFHCGAAIYSEDIVITAAHCLTDRE--TEFLSVRVGSSFTF 84
            |:||||:.|...:......||.. .|.||..:..:.||:|||||...|.  :::|:|...|....
  Fly    45 RVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGGASKLND 109

  Fly    85 FGGQVVRVSSVLLHEEYDQSWSN-DIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAI 148
            .|.| .:|..|:...|:.:...| |:|::||:..:: |.::..:.|.......|:...|||||..
  Fly   110 RGIQ-RQVKEVIKSAEFREDDMNMDVAILRLKKPMK-GKSLGQLILCKKQLMPGTELRVSGWGLT 172

  Fly   149 GFKKNYPMSIL-SASVDIVDQDQCRRSY------GRK---------ITKDMICAAAPG-KDACSG 196
            ...:..|..:| :.:|.:||:.:||.||      ..|         :|..|.||...| ||||:.
  Fly   173 ENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCAGVLGKKDACTF 237

  Fly   197 DSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIE 242
            |||||||..|::.||||||..||...|.|||.::..:||:|..:|:
  Fly   238 DSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFIEQSIK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 81/234 (35%)
Tryp_SPc 24..237 CDD:238113 80/233 (34%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 81/234 (35%)
Tryp_SPc 46..280 CDD:238113 81/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.