DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG11037

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:230 Identity:83/230 - (36%)
Similarity:125/230 - (54%) Gaps:10/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSV-PWQASILRLGRFHCGAAIYSEDIVITAAHCLTDR--ETEFLSVRVGSSFTF 84
            |::||.:.|...: .:..::|....|.||..:.:|:||:|||||...|  .:|:: |..|.|...
  Fly    61 RVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMKASEWI-VAAGISNLN 124

  Fly    85 FGGQVVRVSSVLLHEEYDQSWSN-DIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAI 148
            ..|....|...:|.|::.:...| |:||:.|::.|: ...:..:.|.......|....|||||..
  Fly   125 QKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK-AKNIGTLSLCSVSLKPGVELVVSGWGMT 188

  Fly   149 GFKKNYPMSIL-SASVDIVDQDQCRRSY--GRKITKDMICAAAPG-KDACSGDSGGPLVSGNKLV 209
            ..:...|.::| :.:|.|:.:..||.:|  ..|||..|||||..| ||||:.|||||||...::.
  Fly   189 APRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDACTFDSGGPLVFKKQVC 253

  Fly   210 GIVSFGKECAHPEYPGVYANVAELKPWILGAIERI 244
            ||||||..||...|||||.:|..:||:|..:|:.:
  Fly   254 GIVSFGIGCASNRYPGVYTDVMYVKPFIEKSIKAL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 81/221 (37%)
Tryp_SPc 24..237 CDD:238113 80/220 (36%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 81/221 (37%)
Tryp_SPc 62..283 CDD:238113 81/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.