DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Sems

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:229 Identity:81/229 - (35%)
Similarity:116/229 - (50%) Gaps:8/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILR-LGRFHCGAAIYSEDIVITAAHCLTDR-ETEFLSVRVGSSFTFF 85
            |::||.:.|...:......:| ...|.||..:..|.||:|||||..|| |.|..||..|.|....
  Fly    43 RVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSE 107

  Fly    86 GGQVVRVSSVLLHEEYDQSWSN-DIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIG 149
            .|...:|...:...::.....| |:||:.|...: :|..:..:.|..|....|....|||||...
  Fly   108 KGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWGMTN 171

  Fly   150 FKKNYPMSIL-SASVDIVDQDQCRRSYGR--KITKDMICAAAPG-KDACSGDSGGPLVSGNKLVG 210
            .....|..:| :.||.::::..||.:|..  .|:..|.||:..| ||||:.|||||||...::.|
  Fly   172 PDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCG 236

  Fly   211 IVSFGKECAHPEYPGVYANVAELKPWILGAIERI 244
            |||||..||...|||||.:|..:||:|:..|:.:
  Fly   237 IVSFGIGCASRRYPGVYTDVHYVKPFIVKGIKAL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 79/220 (36%)
Tryp_SPc 24..237 CDD:238113 78/219 (36%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 79/220 (36%)
Tryp_SPc 44..265 CDD:238113 79/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.