DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG16998

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:239 Identity:93/239 - (38%)
Similarity:127/239 - (53%) Gaps:24/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFG 86
            ||||||..:.|...||.|||...|.:.|.:|:.:...::||.||:  :..:..|||.||:||..|
  Fly    23 ERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV--QYPDSYSVRAGSTFTDGG 85

  Fly    87 GQVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPAT--VSGWGAI 148
            ||...|.||:||.::: ::..||||:::|.....||..:.|:.| ..|..:..|.|  |:|||  
  Fly    86 GQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKL-PLPSLNILPRTLLVAGWG-- 147

  Fly   149 GFKKNYPMSILSAS--------VDIVDQDQCRRSYG---RKITKDMICAAAPGKDACSGDSGGPL 202
                 .|.:..|.|        |.:::|..|:|.|.   |.||.||:|||..|:|.|.||||.||
  Fly   148 -----NPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAGRDHCYGDSGAPL 207

  Fly   203 VSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERITK 246
            |......|||||...||.|.:||||..:|....||...:|...|
  Fly   208 VHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLENDRK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 88/227 (39%)
Tryp_SPc 24..237 CDD:238113 87/226 (38%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 88/227 (39%)
Tryp_SPc 25..242 CDD:238113 87/226 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.