DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG32271

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:252 Identity:85/252 - (33%)
Similarity:126/252 - (50%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVQWIFL-AFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAH 64
            |...|:.| ...:...:||....|||||..:.|.|||:..::...|.|.||.::.:...|:||||
  Fly     1 MATLWLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAH 65

  Fly    65 CLTDRETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEYDQSW----------SNDIAVMRLQSKLR 119
            |:..         :|:|.......|.|::...:....|:.:          ::|:||::|::.:.
  Fly    66 CVKG---------IGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS 121

  Fly   120 LGSAVSVIPLADTPPASGSPATVSGWGAIGFK-KNYPMSILSASVDIVDQDQCRRSYGRK--ITK 181
             |..||.|.|.:|...:|....|||||.|..: |...|.:.|..|.::.:..|...|..:  ||.
  Fly   122 -GPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITN 185

  Fly   182 DMICAAAPG-KDACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWI 237
            .|.||:.|| ||||.||||||.|...:|.||||:|..||....||||.||..::.:|
  Fly   186 TMFCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 79/227 (35%)
Tryp_SPc 24..237 CDD:238113 78/226 (35%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 79/227 (35%)
Tryp_SPc 25..244 CDD:238113 79/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.