DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG3650

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:234 Identity:87/234 - (37%)
Similarity:133/234 - (56%) Gaps:6/234 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VSSNWIPERIVGGDLITILSVPWQASILRL-GRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRV 78
            ::|..|..|||||...|:.:|......||. |.|:||.::.:...|:||||||...:...::|:.
  Fly    17 LASGQIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAHCLKGYQASRITVQG 81

  Fly    79 GSSFTFFGGQVVRVSSVLLHEEYDQSWSN-DIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATV 142
            |.|.....|.|.||:...:...:..|..| |:.|:||||.| .||.::.|||.......|:...|
  Fly    82 GVSKLSQSGVVRRVARYFIPNGFSSSSLNWDVGVIRLQSAL-TGSGITTIPLCQVQWNPGNYMRV 145

  Fly   143 SGWGAIGFKKNYPMSIL-SASVDIVDQDQCRRSY-GR-KITKDMICAAAPGKDACSGDSGGPLVS 204
            ||||...:..:.|.:.| :..:.::.:..|:|:| || .:|....||...|||:|||||||.::.
  Fly   146 SGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTASTFCARTGGKDSCSGDSGGGVIF 210

  Fly   205 GNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIER 243
            .|:|.||||:|..||:.:|||||.:|..::.:||.:|::
  Fly   211 KNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFILRSIKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 82/218 (38%)
Tryp_SPc 24..237 CDD:238113 81/217 (37%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 82/218 (38%)
Tryp_SPc 26..243 CDD:238113 81/217 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.