DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG32270

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:246 Identity:91/246 - (36%)
Similarity:126/246 - (51%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WIPE------------RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRET 71
            ||.|            |||||....:...|...:|.|.|.|.||.::.:...|:||||||.|...
  Fly    14 WIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNP 78

  Fly    72 EFLSVRVGSSFTFFGGQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSKLRLGSAVSVIPLADTPPA 135
            ....||.|.::.........|..:|:...|.: :..:|:|:::|:..|: .|....|.||...|.
  Fly    79 SDFVVRGGVTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPR 142

  Fly   136 SGSPATVSGWGAI-GFKKNYPMSILSASVDIVDQDQCR---RSYGRKITKDMICAAAPG-KDACS 195
            .||...|||||.. ....:.|..:.|..|.::.|.:||   |.| |.||..|.||:.|| ||||:
  Fly   143 PGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGY-RNITSSMFCASVPGLKDACA 206

  Fly   196 GDSGGPLVSGNK-LVGIVSFGK--ECAHPEYPGVYANVAELKPWILGAIER 243
            ||||||:|:.|. |||:||:|:  .||..:.||||::|:.|..||...|.|
  Fly   207 GDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNIHR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 84/222 (38%)
Tryp_SPc 24..237 CDD:238113 83/221 (38%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 84/222 (38%)
Tryp_SPc 31..254 CDD:238113 85/224 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.