DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG9897

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:256 Identity:80/256 - (31%)
Similarity:118/256 - (46%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VVSSNWI---PERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLS 75
            :|:..|:   .:||:.|:.:.|...||.|||:...:..||.||.|::.::|||.|:.......:.
  Fly    10 IVALPWLALGDQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCVDGYSARSIQ 74

  Fly    76 VRVGSSFTFFGGQVVRVSSVLLHEEYDQSW--SNDIAVMRLQSKLRLGSAVSVIPLADTPPASGS 138
            ||:|:|.....|.:..:..|.:|.:| .||  .|::|:::....|.....:..|..||..|...|
  Fly    75 VRLGTSSCGTSGSIAGICKVKVHSQY-SSWRFDNNLALLKTCELLNTTDEIKPIERADKVPDDNS 138

  Fly   139 PATVSGWGAIGFKKNY--------------------PMSILSASVDIVDQDQCRRS------YGR 177
            .|.|:|.|  |...|:                    |:.:....|.|:.|.||...      |..
  Fly   139 RANVTGCG--GRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADWKVIPFYLL 201

  Fly   178 KITKDM-ICAAAPGKDACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWI 237
            |...|: ||..:|||.|||.|.|.|||..||||||:| ...|:..  |.||||:.....|:
  Fly   202 KGISDLTICTKSPGKGACSTDRGSPLVIDNKLVGILS-RAGCSIK--PDVYANILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 77/242 (32%)
Tryp_SPc 24..237 CDD:238113 76/241 (32%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.