DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and thetaTry

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:247 Identity:99/247 - (40%)
Similarity:138/247 - (55%) Gaps:19/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TVVSSNWIP----ERIVGGDLITILSVPWQASI-LRLGRFHCGAAIYSEDIVITAAHCLTDRETE 72
            ||..||..|    .|||||:..||.:.|:|.|: .:.|...||.::.:||.|:||||||..|:..
  Fly    20 TVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVS 84

  Fly    73 FLSVRVGSSFTFFGGQVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPAS 136
            .:.||:||:....||.||.|..:..:|:|: ::...|:.:::|..|::....:..|.||...|.:
  Fly    85 KVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPT 149

  Fly   137 GSPATVSGWGAIGFKKNY------PMSILSASVDIVDQDQC---RRSYGRKITKDMICAAAPGKD 192
            |:.|.|:|||:    |.|      |.::....|:|||...|   ...||..|...|:||....||
  Fly   150 GTTAVVTGWGS----KCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEKKKD 210

  Fly   193 ACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERI 244
            ||.|||||||..||.||||||:|..||....||||::|..|:.|||.|.|.:
  Fly   211 ACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNASETL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 89/224 (40%)
Tryp_SPc 24..237 CDD:238113 88/223 (39%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 89/224 (40%)
Tryp_SPc 35..255 CDD:238113 88/223 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.