DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and etaTry

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:234 Identity:100/234 - (42%)
Similarity:129/234 - (55%) Gaps:25/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLGRFH---------CGAAIYSEDIVITAAHCLTDRETE-FLSVR 77
            |||||   ...|..:...:::|.|..         ||..|.....:.|||||:.:||.| ||.|.
  Fly    27 RIVGG---ADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAENFLVVA 88

  Fly    78 VGSSFTFFGGQVVRVSSVLLHEEYDQS-WSNDIAVMRLQSKLRLG--SAVSVIPLADTPPASGSP 139
            ...|.....|.|||||.::.||.|:.| ..||||::.:...|.|.  |.:..|.:|...||.|..
  Fly    89 GDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQ 153

  Fly   140 ATVSGWGAIGFKKNYPMS---ILSASVDIVDQDQCRRS-YGRKITKDMICA--AAPGKDACSGDS 198
            ||:|||   |:.|...:|   :....|.|||.::|:.: |.|.|::.|:||  :..|||||.|||
  Fly   154 ATISGW---GYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLCAGLSEGGKDACQGDS 215

  Fly   199 GGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWI 237
            |||||..|||.||||:|:.||.|.|||||||||..|.||
  Fly   216 GGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 98/232 (42%)
Tryp_SPc 24..237 CDD:238113 97/231 (42%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 98/232 (42%)
Tryp_SPc 28..257 CDD:238113 99/233 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.